Proteintech, 22492-1-AP, C5 Polyclonal antibody

Size: 20ul / 150ul The C5 (22492-1-AP) by Proteintech is a Polyclonal antibody targeting C5 in WB, ELISA applications with reactivity to human, mouse, rat samples 22492-1-AP targets C5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human plasma, rat plasma, mouse serum Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information The complement system is an important effector that bridges the innate and adaptive immune systems. The fifth component of complement, C5, is part of the complement cascade and plays an important role in inflammation and cell killing. It consists of disulfide-linked alpha and beta polypeptide chains but can be cleaved into two active peptides (C5a and C5b) by C5 convertases. Mutations and defects in C5 are associated with severe recurrent infections. This antibody specifically recognizes the C5 alpha chain and C5b.(PMID: 20010915; PMID: 8011297; PMID: 6554279) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17882 Product name: Recombinant human C5, C5a protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1418-1676 aa of BC113740 Sequence: GSSHAVMDISLPTGISANEEDLKALVEGVDQLFTDYQIKDGHVILQLNSIPSSDFLCVRFRIFELFEVGFLSPATFTVYEYHRPDKQCTMFYSTSNIKIQKVCEGAACKCVEADCGQMQEELDLTISAETRKQTACKPEIAYAYKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC Predict reactive species Full Name: complement component 5 Calculated Molecular Weight: 1676 aa, 188 kDa Observed Molecular Weight: 120 kDa, 70 kDa GenBank Accession Number: BC113740 Gene Symbol: C5 Gene ID (NCBI): 727 RRID: AB_3669399 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P01031 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.