Proteintech, 22527-1-AP, TMEM168 Polyclonal antibody

Size: 20ul / 150ul The TMEM168 (22527-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM168 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 22527-1-AP targets TMEM168 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, PC-3 cells, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18337 Product name: Recombinant human TMEM168 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 188-428 aa of BC030804 Sequence: FHELGNCLGGTSVGYAIVIPTNFCSPDGQPTLLPPEHVQELNLRSTGMLNAIQRFFAYHMIETYGCDYSTSGLSFDTLHSKLKAFLELRTVDGPRHDTYILYYSGHTHGTGEWALAGGDTLRLDTLIEWWREKNGSFCSRLIIVLDSENSTPWVKEVRKINDQYIAVQGAELIKTVDIEEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTLHLPTGSDVAKHWM Predict reactive species Full Name: transmembrane protein 168 Calculated Molecular Weight: 697 aa, 80 kDa Observed Molecular Weight: 110-130 kDa GenBank Accession Number: BC030804 Gene Symbol: TMEM168 Gene ID (NCBI): 64418 RRID: AB_2879118 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9H0V1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.