Proteintech, 22592-1-AP, SORLA Polyclonal antibody

Size: 20ul / 150ul The SORLA (22592-1-AP) by Proteintech is a Polyclonal antibody targeting SORLA in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 22592-1-AP targets SORLA in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissue, human brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information SorLA also known as SorL1 or LR11, is a multiligand receptor belonging to the LDL receptor superfamily. It is also a member of vacuolar protein sorting-10 (Vps10) family and is enriched in the brain. SorLA acts as an sorting receptor for APP and prevents amyloidogenic processing of APP. Downregulation of SorLA has been found in patients with sporadic Alzheimer disease (AD). Currently SorLA has emerged as a potential target for AD therapy. (25404298) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18445 Product name: Recombinant human SORL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1865-2214 aa of BC137171 Sequence: PRNVVYGIFYATSFLDLYRNPKSLTTSLHNKTVIVSKDEQYLFLVRVVVPYQGPSSDYVVVKMIPDSRLPPRHLHVVHTGKTSVVIKWESPYDSPDQDLLYAIAVKDLIRKTDRSYKVKSRNSTVEYTLNKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVLLFWKSLALKEKHFNESRGYEIHMFDSAMNITAYLGNTTDNFFKISNLKMGHNYTFTVQARCLFGNQICGEPAILLYDELGSGADASATQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSFTAFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA Predict reactive species Full Name: sortilin-related receptor, L(DLR class) A repeats-containing Calculated Molecular Weight: 2214 aa, 248 kDa Observed Molecular Weight: 300 kDa GenBank Accession Number: BC137171 Gene Symbol: SORLA Gene ID (NCBI): 6653 RRID: AB_2879131 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q92673 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.