Proteintech, 22601-1-AP, VEGF-C Polyclonal antibody

Size: 20ul / 150ul The VEGF-C (22601-1-AP) by Proteintech is a Polyclonal antibody targeting VEGF-C in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 22601-1-AP targets VEGF-C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, RAW 264.7 cells, HCT 116 cells, SW480 cells Positive IHC detected in: human prostate cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information VEGFC is a member of the platelet-derived growth factor / vascular endothelial growth factor (PDGF/VEGF) family. The main function of VEGFC is to promote the growth of lymphatic vessels (lymphangiogenesis). It acts on lymphatic endothelial cells (LECs) primarily via its receptor VEGFR-3 promoting survival, growth, and migration. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18182 Product name: Recombinant human VEGFC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 179-228 aa of BC035212 Sequence: SYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRS Predict reactive species Full Name: vascular endothelial growth factor C Calculated Molecular Weight: 419 aa, 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC035212 Gene Symbol: VEGFC Gene ID (NCBI): 7424 RRID: AB_2879132 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49767 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.