Iright
BRAND / VENDOR: Proteintech

Proteintech, 22641-1-AP, ATOX1 Polyclonal antibody

CATALOG NUMBER: 22641-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATOX1 (22641-1-AP) by Proteintech is a Polyclonal antibody targeting ATOX1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 22641-1-AP targets ATOX1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells, A549 cells, HEK-293T cells, NCI-H1299 cells, HEK-293 cells Positive IHC detected in: human prostate hyperplasia tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Antioxidant 1 (ATOX1) is a copper chaperone to regulate copper homeostasis in cell. In the cytosol, ATOX1 always binds to copper and transfer to ATPase proteins in the trans-Golgi network, thereby promoting copper supply to various copper-dependent oxidereductases matured within the secretory vesicles (PMID: 28294521). Also, the protein could protect cells against oxidative damage and the expression levels of ATOX1 may help to the inflammatory response and antioxidant defense,even to modulate response to the cancer (PMID: 27472369). ATOX1 plays an important role in the physiology of the human central nervous system ,and it's highly expressed in the cerebral cortex and hippocampus (PMID: 30545441). Either cytosol or nucleus location of ATOX1 has been reported in different literations, which may be associated with cell status (PMID: 24445997; 31317143). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18460 Product name: Recombinant human ATOX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC112248 Sequence: MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE Predict reactive species Full Name: ATX1 antioxidant protein 1 homolog (yeast) Calculated Molecular Weight: 68 aa, 8 kDa Observed Molecular Weight: 7 kDa GenBank Accession Number: BC112248 Gene Symbol: ATOX1 Gene ID (NCBI): 475 RRID: AB_2879139 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00244 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924