Iright
BRAND / VENDOR: Proteintech

Proteintech, 22722-1-AP, WHSC1 Polyclonal antibody

CATALOG NUMBER: 22722-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WHSC1 (22722-1-AP) by Proteintech is a Polyclonal antibody targeting WHSC1 in WB, IP, IHC, ELISA applications with reactivity to human samples 22722-1-AP targets WHSC1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells Positive IP detected in: HeLa cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information WHSC1 (also known as MMSET or NSD2) is a SET domain containing histone lysine methyltransferase that can di- and trimethylate histone H3 at lysine 36 (H3K36). WHSC1 mRNA is highly expressed in embryonic tissues, especially those with high degrees of proliferation, whereas in adult tissues,the mRNA is primarily expressed in thymus and testis. WHSC1 is implicated in cellular adhesion, clonogenic growth and tumorigenicity. Its overexpression has been found in various cancers. It undergoes alternative splicing resulting in different protein isoforms. Recently WHSC1 has been identified as a critical epigenetic regulator for Tfh differentiation. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18611 Product name: Recombinant human WHSC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 553-712 aa of BC152412 Sequence: RPKTSTTLSSEEKGKKTKKKTRRRRAKGEGKRQSEDECFRCGDGGQLVLCDRKFCTKAYHLSCLGLGKRPFGKWECPWHHCDVCGKPSTSFCHLCPNSFCKEHQDGTAFSCTPDGRSYCCEHDLGAASVRSTKTEKPPPEPGKPKGKRRRRRGWRRVTEG Predict reactive species Full Name: Wolf-Hirschhorn syndrome candidate 1 Calculated Molecular Weight: 162 kDa Observed Molecular Weight: 70 kDa, 150 kDa GenBank Accession Number: BC152412 Gene Symbol: WHSC1 Gene ID (NCBI): 7468 RRID: AB_2879156 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: O96028 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924