Iright
BRAND / VENDOR: Proteintech

Proteintech, 22723-1-AP, ARK5 Polyclonal antibody

CATALOG NUMBER: 22723-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ARK5 (22723-1-AP) by Proteintech is a Polyclonal antibody targeting ARK5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 22723-1-AP targets ARK5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat heart tissue, mouse heart tissue Positive IHC detected in: human colon cancer tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NUAK1 is a member of the human adenosine monophosphate (AMP)-activated protein kinase family that has been identified as a key tumor cell survival factor. It is also named as ARK5, KIAA0537, OMPHK1 and belongs to the protein kinase superfamily. The physiological role of NUAK1 is potentially to suppress glucose uptake through negative regulation of INS signaling in oxidative muscle. This protein has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18612 Product name: Recombinant human NUAK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 515-662 aa of BC152462 Sequence: HSLSCRRKGILKHSSKYSAGTMDPALVSPEMPTLESLSEPGVPAEGLSRSYSRPSSVISDDSVLSSDSFDLLDLQENRPARQRIRSCVSAENFLQIQDFEGLQNRPRPQYLKRYRNRLADSSFSLLTDMDDVTQVYKQALEICSKLN Predict reactive species Full Name: NUAK family, SNF1-like kinase, 1 Calculated Molecular Weight: 661 aa, 74 kDa Observed Molecular Weight: 74 kDa GenBank Accession Number: BC152462 Gene Symbol: ARK5 Gene ID (NCBI): 9891 RRID: AB_2879157 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: O60285 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924