Iright
BRAND / VENDOR: Proteintech

Proteintech, 22762-1-AP, SARDH Polyclonal antibody

CATALOG NUMBER: 22762-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SARDH (22762-1-AP) by Proteintech is a Polyclonal antibody targeting SARDH in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 22762-1-AP targets SARDH in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SARDH is a mitochondrial flavoenzyme that oxidizes sarcosine to glycine, feeding one-carbon units into folate metabolism. By tuning methyl-group balance, it modulates epigenetic programs and immune fate. Silencing or mutation of SARDH drives sarcosine accumulation, fueling invasion in prostate, liver, breast and kidney cancers, whereas its high expression predicts favorable prognosis. Thus SARDH acts as a metabolic tumor-suppressor and an emerging therapeutic target. (PMID: 23824605; 40830700; 31545450) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18738 Product name: Recombinant human SARDH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 309-430 aa of BC136364 Sequence: NVRDHDASVYLRLQGDALSVGGYEANPIFWEEVSDKFAFGLFDLDWEVFTQHIEGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGGCGQELAHWIIH Predict reactive species Full Name: sarcosine dehydrogenase Calculated Molecular Weight: 918 aa, 101 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC136364 Gene Symbol: SARDH Gene ID (NCBI): 1757 RRID: AB_2879162 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UL12 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924