Iright
BRAND / VENDOR: Proteintech

Proteintech, 22779-1-AP, LIFR Polyclonal antibody

CATALOG NUMBER: 22779-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LIFR (22779-1-AP) by Proteintech is a Polyclonal antibody targeting LIFR in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse samples 22779-1-AP targets LIFR in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human skeletal muscle tissue, HeLa cells, human placenta tissue, mouse skeletal muscle tissue Positive IP detected in: mouse skeletal muscle tissue Positive IHC detected in: human skeletal muscle tissue, human kidney tissue, human placenta tissue, mouse cerebellum tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse cerebellum tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information LIFR, also known as CD118, is a subunit of a receptor for leukemia inhibitory factor (LIF). LIF is a pleiotropic cytokine of the interleukin-6 family which affects the differentiation, survival, and proliferation of a wide variety of cells in the adult and the embryo. LIFR is the low-affinity binding chain that, together with the high-affinity converter subunit gp130, forms a high-affinity receptor complex that mediates the action of LIF. The high-affinity complex also binds a related cytokine, oncostatin M (PMID: 8999038). LIFR has also been identified as a breast cancer metastasis suppressor that functions through the HIPPO-YAP pathway (PMID: 23001183). LIFR appeared as doublets with 190 and 170 kDa (PMID: 10858440). They represented different glycosylated forms of the LIFR in different steps of protein maturation. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18742 Product name: Recombinant human LIFR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 906-1097 aa of BC153096 Sequence: NNVEVLETRSAFPKIEDTEIISPVAERPEDRSDAEPENHVVVSYCPPIIEEEIPNPAADEAGGTAQVIYIDVQSMYQPQAKPEEEQENDPVGGAGYKPQMHLPINSTVEDIAAEEDLDKTAGYRPQANVNTWNLVSPDSPRSIDSNSEIVSFGSPCSINSRQFLIPPKDEDSPKSNGGGWSFTNFFQNKPND Predict reactive species Full Name: leukemia inhibitory factor receptor alpha Calculated Molecular Weight: 1097 aa, 124 kDa Observed Molecular Weight: 190 kDa, 170 kDa GenBank Accession Number: BC153096 Gene Symbol: LIFR Gene ID (NCBI): 3977 RRID: AB_2879165 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P42702 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924