Iright
BRAND / VENDOR: Proteintech

Proteintech, 22803-1-AP, IGF2BP1 Polyclonal antibody

CATALOG NUMBER: 22803-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IGF2BP1 (22803-1-AP) by Proteintech is a Polyclonal antibody targeting IGF2BP1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 22803-1-AP targets IGF2BP1 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, HuH-7 cells, Jurkat cells, mouse kidney tissue Positive IP detected in: HEK-293 cells Positive IHC detected in: human lung cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A375 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information IGF2BP1, also named as CRDBP, VICKZ1, ZBP1, is a 577 amino acid protein, which belongs to the RRM IMP/VICKZ family. IGF2BP1 can form homodimers and heterodimers with IGF2BP1 and IGF2BP3. IGF2BP1 is mainly expressed in the embryo, including in fetal liver, fetal lung, fetal kidney, fetal thymus and also expressed follicles of ovary, as well as in gonocytes of testis, spermatogonia, semen, oocytes and placenta. IGF2BP1 is Expressed in various cancers, including testis and lung cancers, as well as kidney, prostate and trachea cancers. IGF2BP1 as RNA-binding factor that recruits target transcripts to cytoplasmic protein-RNA complexes (mRNPs). It also modulates the rate and location at which target transcripts encounter the translational apparatus and shields them from endonuclease attacks or microRNA-mediated degradation. The calcualted molecular weight of IGF2BP1 is 63 kDa, but modified IGF2BP1 is about 65-70 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, chicken, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18859 Product name: Recombinant human IGF2BP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 126-198 aa of BC156957 Sequence: YSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPL Predict reactive species Full Name: insulin-like growth factor 2 mRNA binding protein 1 Calculated Molecular Weight: 577 aa, 63 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC156957 Gene Symbol: IGF2BP1 Gene ID (NCBI): 10642 RRID: AB_2879173 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NZI8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924