Iright
BRAND / VENDOR: Proteintech

Proteintech, 22843-1-AP, GATSL2 Polyclonal antibody

CATALOG NUMBER: 22843-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GATSL2 (22843-1-AP) by Proteintech is a Polyclonal antibody targeting GATSL2 in WB, ELISA applications with reactivity to human, Rat samples 22843-1-AP targets GATSL2 in WB, ELISA applications and shows reactivity with human, Rat samples. Tested Applications Positive WB detected in: rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information GATSL2,also named CASTOR2, lacks an arginine-binding capacity and is constitutively associated with GATOR2 complex, resulting in persistent mTORC1 inactivation. Specification Tested Reactivity: human, Rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18791 Product name: Recombinant human GATSL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 137-257 aa of BC147030 Sequence: HTLSSEFTILRVVNGETVAAENLGITNGFVKPKLVQRPVIHPLSSPSNRFCVTSLDPDTLPAVATLLMDVMFYSNGVKDPMATGDDCGHIRFFSFSLIEGYISLVMDVQTQQRFPSNLLFT Predict reactive species Full Name: GATS-like protein 2 Calculated Molecular Weight: 329 aa, 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC147030 Gene Symbol: GATSL2 Gene ID (NCBI): 729438 RRID: AB_3085703 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: A6NHX0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924