Iright
BRAND / VENDOR: Proteintech

Proteintech, 22882-1-AP, MEX3C Polyclonal antibody

CATALOG NUMBER: 22882-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MEX3C (22882-1-AP) by Proteintech is a Polyclonal antibody targeting MEX3C in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 22882-1-AP targets MEX3C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, PC-3 cells Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information MEX3C(RNA-binding E3 ubiquitin-protein ligase MEX3C) is also named as RKHD2, RNF194 and may be involved in post-transcriptional regulatory mechanisms. MEX3C is necessary for normal postnatal growth and enhances the expression of local bone Igf1 expression(PMID:22927639). This protein is expressed in the cytoplasm and shuttles between the cytoplasm and the nucleus through the CRM1 export pathway. At least three MEX3C protein variants can be expressed by alternative splicing and alternative transcription initiation: MEX3C659AA(containing 659 amino acid residues, about 82 kDa), MEX3C464AA(about 64 kDa) and MEX3C372AA(about 50 kDa)(PMID: 28982131,27053362,22863774). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18931 Product name: Recombinant human MEX3C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 265-415 aa of BC148855 Sequence: GSNRLADFSPTSPFSTGNFWFGDTLPSVGSEDLAVDSPAFDSLPTSAQTIWTPFEPVNPLSGFGSDPSGNMKTQRRGSQPSTPRLSPTFPESIEHPLARRVRSDPPSTGNHVGLPIYIPAFSNGTNSYSSSNGGSTSSSPPESRRKHDCVI Predict reactive species Full Name: mex-3 homolog C (C. elegans) Calculated Molecular Weight: 659 aa, 69 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC148855 Gene Symbol: MEX3C Gene ID (NCBI): 51320 RRID: AB_2879183 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5U5Q3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924