Iright
BRAND / VENDOR: Proteintech

Proteintech, 22915-1-AP, Caspase 1/P20 Polyclonal antibody

CATALOG NUMBER: 22915-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Caspase 1/P20 (22915-1-AP) by Proteintech is a Polyclonal antibody targeting Caspase 1/P20 in WB, IHC, IF, ELISA applications with reactivity to human samples 22915-1-AP targets Caspase 1/P20 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, HepG2 cells, THP-1 cells, U-937 cells, PC-12 cells Positive IHC detected in: human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF): IF : 1:10-1:100 Background Information CASP1(caspase-1) is also named as IL1BC, IL1BCE and belongs to the peptidase C14A family. It is a cysteine protease that regulates inflammatory processes through its capacity to process and activate the interleukin-1-beta (IL1B), IL18, and IL33 precursor proteins. The active caspase-1 can increase cellular membrane permeability and intracellular calcium levels, which facilitates lysosome exocytosis and release of host antimicrobial factors and microbial products (PMID:21804020). It has 5 isoforms produced by alternative splicing. 22915-1-AP can recognize p45 procaspase and the mature fragment p20. Specification Tested Reactivity: human Cited Reactivity: human, pig, rabbit, canine, monkey, chicken, hamster, duck Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11143 Product name: Recombinant human Caspase 1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-311 aa of BC062327 Sequence: MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH Predict reactive species Full Name: caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase) Calculated Molecular Weight: 404 aa, 45 kDa Observed Molecular Weight: 45-47 kDa, 30 kDa, 35 kDa GenBank Accession Number: BC062327 Gene Symbol: Caspase 1 Gene ID (NCBI): 834 RRID: AB_2876874 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P29466 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924