Proteintech, 22936-1-AP, ACOT6 Polyclonal antibody

Size: 20ul / 150ul The ACOT6 (22936-1-AP) by Proteintech is a Polyclonal antibody targeting ACOT6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 22936-1-AP targets ACOT6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, HeLa cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18981 Product name: Recombinant human ACOT6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 37-126 aa of BC126380 Sequence: TVLINACVANTVAPLHYKDMIIPKLVDDLGKVKITKSGFLTFMDTWSNPLEEHNHQSLVPLEKAQVPFLFIVGMDDQSWKSEFYAQIASE Predict reactive species Full Name: acyl-CoA thioesterase 6 Calculated Molecular Weight: 207 aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC126380 Gene Symbol: ACOT6 Gene ID (NCBI): 641372 RRID: AB_11182380 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q3I5F7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.