Proteintech, 22943-1-AP, CDX4 Polyclonal antibody

Size: 20ul / 150ul The CDX4 (22943-1-AP) by Proteintech is a Polyclonal antibody targeting CDX4 in WB, ELISA applications with reactivity to human, mouse samples 22943-1-AP targets CDX4 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SKOV-3 cells, mouse thymus tissue, Sp2/0 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19078 Product name: Recombinant human CDX4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-167 aa of BC128233 Sequence: MYGSCLLEKEAGMYPGTLMSPGGDGTAGTGGTGGGGSPMPASNFAAAPAFSHYMGYPHMPSMDPHWPSLGVWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVT Predict reactive species Full Name: caudal type homeobox 4 Calculated Molecular Weight: 284 aa, 30 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC128233 Gene Symbol: CDX4 Gene ID (NCBI): 1046 RRID: AB_2879187 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14627 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.