Iright
BRAND / VENDOR: Proteintech

Proteintech, 23082-1-AP, Alpha cardiac muscle actin Polyclonal antibody

CATALOG NUMBER: 23082-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Alpha cardiac muscle actin (23082-1-AP) by Proteintech is a Polyclonal antibody targeting Alpha cardiac muscle actin in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples 23082-1-AP targets Alpha cardiac muscle actin in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue Positive IHC detected in: human normal colon, human colon tissue, human heart tissue, human skeletal muscle tissue, human small intestine tissue, mouse skeletal muscle tissue, mouse heart tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: C2C12 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19482 Product name: Recombinant human ACTC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC009978 Sequence: MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG Predict reactive species Full Name: actin, alpha, cardiac muscle 1 Calculated Molecular Weight: 377 aa, 42 kDa Observed Molecular Weight: 42-45 kDa GenBank Accession Number: BC009978 Gene Symbol: ACTC1 Gene ID (NCBI): 70 RRID: AB_2879206 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P68032 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924