Iright
BRAND / VENDOR: Proteintech

Proteintech, 23092-1-AP, NCOA7 Polyclonal antibody

CATALOG NUMBER: 23092-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NCOA7 (23092-1-AP) by Proteintech is a Polyclonal antibody targeting NCOA7 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 23092-1-AP targets NCOA7 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, MCF-7 cells, MDA-MB-453 cells, mouse brain tissue, rat brain tissue Positive IP detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Nuclear receptors for steroids, thyroid hormones and retinoic acids are ligand-dependent transcription factors that activate transcription through specific DNA binding sites in their target genes. NCoA-7 (nuclear receptor coactivator 7), also known as ESNA1 or ERAP140, is a 942 amino acid nuclear protein that enhances nuclear receptor transcriptional activities and coactivates several nuclear receptors including PPARG, ESR1, THRB and RARA. Highly expressed in brain and weakly expressed in pancreas, bladder, ovary, spinal cord, prostate, mammary gland, ovary, uterus and stomach, NCoA-7 is a member of the OXR1 family and contains one LysM repeat and a TLD domain. This antibody is a rabbit polyclonal antibody raised against the N-terminal of human NCOA7 protein. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19315 Product name: Recombinant human NCOA7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC137094 Sequence: MDTKEEKKERKQSYFARLKKKKQAKQNAETASAVATRTHTGKEDNNTVVLEPDKCNIAVEEEYMTDEKKKRKSNQLKEIRRTELKRYYSIDDNQNKTHDKKEKKMVVQKPHGTMEYTAGNQDTLNSIALKFNITPNKLVELNKLFTHTIVPGQVLFVPDANSPSSTLRLSSSSPGATVSPSSSDAEYDKLPDADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVVGGVMIVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYNDISHMKIKDALPSDLPQDLCPLYRPGEWEDLASEKDINPFSKFKSINKEKRQQNGEKIMTSDSRPIVP Predict reactive species Full Name: nuclear receptor coactivator 7 Calculated Molecular Weight: 972 aa, 106 kDa Observed Molecular Weight: 120-130 kDa GenBank Accession Number: BC137094 Gene Symbol: NCOA7 Gene ID (NCBI): 135112 RRID: AB_2879208 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NI08 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924