Iright
BRAND / VENDOR: Proteintech

Proteintech, 23140-1-AP, REEP3 Polyclonal antibody

CATALOG NUMBER: 23140-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The REEP3 (23140-1-AP) by Proteintech is a Polyclonal antibody targeting REEP3 in WB, ELISA applications with reactivity to human samples 23140-1-AP targets REEP3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, L02 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information REEP3 (Receptor Expression-Enhancing Protein 3) is a member of the REEP family of proteins, a transmembrane protein that interacts with odorant receptor proteins and may enhance the odorant receptor responses to odorants. It primarily regulates the tubular morphology of the endoplasmic reticulum by promoting high membrane curvature through its reticular homology domains. During mitosis, REEP3 binds to microtubules, separating the endoplasmic reticulum from chromosomes to ensure proper nuclear membrane remodeling and cell division.(PMID: 23911198; 30995177) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19400 Product name: Recombinant human REEP3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 73-255 aa of BC068557 Sequence: VIWLLSPYTKGASLIYRKFLHPLLSSKEREIDDYIVQAKERGYETMVNFGRQGLNLAATAAVTAAVKSQGAITERLRSFSMHDLTTIQGDEPVGQRPYQPLPEAKKKSKPAPSESAGYGIPLKDGDEKTDEEAEGPYSDNEMLTHKGLRRSQSMKSVKTTKGRKEVRYGSLKYKVKKRPQVYF Predict reactive species Full Name: receptor accessory protein 3 Calculated Molecular Weight: 255 aa, 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC068557 Gene Symbol: REEP3 Gene ID (NCBI): 221035 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6NUK4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924