Proteintech, 23142-1-AP, TMEM127 Polyclonal antibody

Size: 20ul / 150ul The TMEM127 (23142-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM127 in IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 23142-1-AP targets TMEM127 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IP detected in: HeLa cells Positive IHC detected in: human stomach cancer tissue, human heart tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19472 Product name: Recombinant human TMEM127 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 139-238 aa of BC039892 Sequence: QCATVIGFSYWASELILAQQQQHKKYHGSQVYVTFAVSFYLVAGAGGASILATAANLLRHYPTEEEEQALELLSEMEENEPYPAEYEVINQFQPPPAYTP Predict reactive species Full Name: transmembrane protein 127 Calculated Molecular Weight: 238 aa, 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC039892 Gene Symbol: TMEM127 Gene ID (NCBI): 55654 RRID: AB_2879217 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: O75204 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.