Proteintech, 23149-1-AP, FAM46B Polyclonal antibody

Size: 20ul / 150ul The FAM46B (23149-1-AP) by Proteintech is a Polyclonal antibody targeting FAM46B in ELISA applications with reactivity to human samples 23149-1-AP targets FAM46B in WB, IF, IHC, ELISA applications and shows reactivity with human samples. Specification Tested Reactivity: human Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19523 Product name: Recombinant human FAM46B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-66 aa of BC014160 Sequence: MPSESGAERRDRAAAQVGTAAATAVATAAPAGGGPDPEALSAFPGRHLSGLSWPQVKRLDALLSEP Predict reactive species Full Name: family with sequence similarity 46, member B Calculated Molecular Weight: 424 aa, 47 kDa GenBank Accession Number: BC014160 Gene Symbol: FAM46B Gene ID (NCBI): 115572 RRID: AB_2879218 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96A09 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.