Iright
BRAND / VENDOR: Proteintech

Proteintech, 23163-1-AP, ZFYVE19 Polyclonal antibody

CATALOG NUMBER: 23163-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZFYVE19 (23163-1-AP) by Proteintech is a Polyclonal antibody targeting ZFYVE19 in WB, IHC, ELISA applications with reactivity to human samples 23163-1-AP targets ZFYVE19 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Raji cells Positive IHC detected in: human liver cancer tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ZFYVE19, also known as ANCHR, is a poorly characterized human protein. Recent clinical studies have linked biallelic loss-of-function mutations to a progressive familial intrahepatic cholestasis (PFIC) phenotype featuring neonatal-onset high-GGT cholestasis, congenital hepatic fibrosis, and sclerosing cholangiopathy. (PMID: 33853651) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19593 Product name: Recombinant human ZFYVE19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 123-471 aa of BC015738 Sequence: VCKQCHEVLTRGSSANASKWSPPQNYKKRVAALEAKQKPSTSQSQGLTRQDQMIAERLARLRQENKPKLVPSQAEIEARLAALKDERQGSIPSTQEMEARLAALQGRVLPSQTPQPAHHTPDTRTQAQQTQDLLTQLAAEVAIDESWKGGGPAASLQNDLNQGGPGSTNSKRQANWSLEEEKSRLLAEAALELREENTRQERILALAKRLAMLRGQDPERVTLQDYRLPDSDDDEDEETAIQRVLQQLTEEAALDEASGFNIPAEQASRPWTQPRGAEPEAQDVDPRPEAEEEELPWCCICNEDATLRCAGCDGDLFCARCFREGHDAFELKEHQTSAYSPPRAGQEH Predict reactive species Full Name: zinc finger, FYVE domain containing 19 Calculated Molecular Weight: 471 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC015738 Gene Symbol: ZFYVE19 Gene ID (NCBI): 84936 RRID: AB_2879219 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96K21 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924