Iright
BRAND / VENDOR: Proteintech

Proteintech, 23164-1-AP, ZSCAN21 Polyclonal antibody

CATALOG NUMBER: 23164-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZSCAN21 (23164-1-AP) by Proteintech is a Polyclonal antibody targeting ZSCAN21 in WB, ELISA applications with reactivity to human samples 23164-1-AP targets ZSCAN21 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19595 Product name: Recombinant human ZSCAN21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 131-282 aa of BC047309 Sequence: GHQVSTPPNEQKPVWEKISSSGTAKESPSSMQPQPLETSHKYESWGPLYIQESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEAEGLKGDIISVIIANKPEASLERQCVNLENEKGTKPPLQEAGSKKGRESVPTKPTPGERRYICAEC Predict reactive species Full Name: zinc finger and SCAN domain containing 21 Calculated Molecular Weight: 473 aa, 54 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC047309 Gene Symbol: ZSCAN21 Gene ID (NCBI): 7589 RRID: AB_2879220 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5A6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924