Iright
BRAND / VENDOR: Proteintech

Proteintech, 23168-1-AP, AFAF/EQTN Polyclonal antibody

CATALOG NUMBER: 23168-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AFAF/EQTN (23168-1-AP) by Proteintech is a Polyclonal antibody targeting AFAF/EQTN in WB, IF/ICC, ELISA applications with reactivity to human samples 23168-1-AP targets AFAF/EQTN in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The AFAF gene (also known as EQTN and C9orf11) encodes a membrane protein that is specifically localized to the acrosomal membrane. AFAF is involved in the process of fertilization and acrosome biogenesis. Expression analysis demonstrates that AFAF is highly expressed in the testis, although minor expression was seen in other tissues. AFAF has 3 isoforms with molecular weights of 14, 29, and 33 kDa. However, one article detected molecular weight between 40-65 kDa in mouse testis (PMID: 19605790). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19656 Product name: Recombinant human C9orf11 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 20-121 aa of BC137351 Sequence: LKPTIEALPNVLPLNEDVNKQEEKNEDHTPNYAPANEKNGNYYKDIKQYVFTTQNPNGTESEISVRATTDLNFALKNDKTVNATTYEKSTIEEETTTSEPSH Predict reactive species Full Name: chromosome 9 open reading frame 11 Calculated Molecular Weight: 294 aa, 33 kDa Observed Molecular Weight: 27-29 kDa GenBank Accession Number: BC137351 Gene Symbol: AFAF Gene ID (NCBI): 54586 RRID: AB_2879222 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQ60 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924