Proteintech, 23183-1-AP, GATC Polyclonal antibody

Size: 20ul / 150ul The GATC (23183-1-AP) by Proteintech is a Polyclonal antibody targeting GATC in IP, IHC, ELISA applications with reactivity to human, mouse samples 23183-1-AP targets GATC in IP, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IP detected in: mouse liver tissue Positive IHC detected in: human liver tissue, human appendicitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GATC encodes a subunit of the glutamyl-tRNA(Gln) amidotransferase protein complex (GatCAB), which plays a role in aminoacylation of mitochondrial glutaminyl mt-tRNA. The complex plays an role in mitochondrial translation and protein synthesis (PubMed: 30283131). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19713 Product name: Recombinant human GATC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-136 aa of BC107145 Sequence: MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS Predict reactive species Full Name: glutamyl-tRNA(Gln) amidotransferase, subunit C homolog (bacterial) Calculated Molecular Weight: 136 aa, 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC107145 Gene Symbol: GATC Gene ID (NCBI): 283459 RRID: AB_2879226 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: O43716 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.