Proteintech, 23277-1-AP, Trefoil factor 3 Polyclonal antibody

Size: 20ul / 150ul The Trefoil factor 3 (23277-1-AP) by Proteintech is a Polyclonal antibody targeting Trefoil factor 3 in IHC, ELISA applications with reactivity to human samples 23277-1-AP targets Trefoil factor 3 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human colon tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information Trefoil factor 3 (TFF3) belongs to the TFF-domain peptide family which consists of three small secreted proteins (TFF1, TFF2, TFF3) that are expressed by mucous-secreting epithelia. TFF3 is a major constituent in the goblet cells in small and large intestines, especially a typical secretary peptide of the normal human antral and pyloric gastric mucosa. TFF3 is essential in regulating cell migration and maintaining normal GI mucosal integrity. TFF3 has been reported to be overexpressed at the gene and the protein level in human neoplasms such as prostate, breast, and colon cancer. TFF3 is involved in tumor cell scattering, angiogenesis, and invasion. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9543 Product name: Recombinant human TFF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC017859 Sequence: MAARALCMLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF Predict reactive species Full Name: trefoil factor 3 (intestinal) Calculated Molecular Weight: 80 aa, 9 kDa GenBank Accession Number: BC017859 Gene Symbol: TFF3 Gene ID (NCBI): 7033 RRID: AB_2879245 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q07654 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.