Proteintech, 23280-1-AP, A2LD1 Polyclonal antibody

Size: 20ul / 150ul The A2LD1 (23280-1-AP) by Proteintech is a Polyclonal antibody targeting A2LD1 in WB, ELISA applications with reactivity to human, mouse, rat samples 23280-1-AP targets A2LD1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, mouse bladder tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18549 Product name: Recombinant human A2LD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-153 aa of BC001077 Sequence: MALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEEPPAPTAVQCFVYSRATFPPEWAQLPHHDSYDSEGPHGLRYNPRENR Predict reactive species Full Name: AIG2-like domain 1 Calculated Molecular Weight: 153 aa, 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC001077 Gene Symbol: A2LD1 Gene ID (NCBI): 87769 RRID: AB_2879246 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BVM4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.