Proteintech, 23296-1-AP, MTERFD1 Polyclonal antibody

Size: 20ul / 150ul The MTERFD1 (23296-1-AP) by Proteintech is a Polyclonal antibody targeting MTERFD1 in WB, ELISA applications with reactivity to human, mouse samples 23296-1-AP targets MTERFD1 in WB, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19847 Product name: Recombinant human MTERFD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 91-409 aa of BC012995 Sequence: MNEQSQKTQNISSFDSELFLEELDELPPLSPMQPISEEEAIQIIADPPLPPASFTLRDYVDHSETLQKLVLLGVDLSKIEKHPEAANLLLRLDFEKDIKQMLLFLKDVGIEDNQLGAFLTKNHAIFSEDLENLKTRVAYLHSKNFSKADVAQMVRKAPFLLNFSVERLDNRLGFFQKELELSVKKTRDLVVRLPRLLTGSLEPVKENMKVYRLELGFKHNEIQHMITRIPKMLTANKMKLTETFDFVHNVMSIPHHIIVKFPQVFNTRLFKVKERHLFLTYLGRAQYDPAKPNYISLDKLVSIPDEIFCEEIAKASVQD Predict reactive species Full Name: MTERF domain containing 1 Calculated Molecular Weight: 417 aa, 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC012995 Gene Symbol: MTERFD1 Gene ID (NCBI): 51001 RRID: AB_2879248 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96E29 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.