Proteintech, 23355-1-AP, FOLR1 Polyclonal antibody

Size: 20ul / 150ul The FOLR1 (23355-1-AP) by Proteintech is a Polyclonal antibody targeting FOLR1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 23355-1-AP targets FOLR1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, JAR cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Folate receptor 1 (FOLR1), also known as folate receptor alpha or adult folate-binding protein (FBP), is a 38-kDa glycoprotein belonging to the folate receptor family (PMID:15094207; 23528302). The receptor binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. FOLR1 is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. FOLR1 expression is often limited to the apical surfaces of epithelium in the lung, kidney and choroid plexus but is differentially overexpressed in a variety of solid tumors such as ovarian cancer, non-small cell lung cancer, breast cancer, kidney cancer and high-grade osteosarcoma (PMID: 23528302; 23357463). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, camelus bactrianus Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19959 Product name: Recombinant human FOLR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 55-93 aa of BC002947 Sequence: EQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMA Predict reactive species Full Name: folate receptor 1 (adult) Calculated Molecular Weight: 257 aa, 30 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC002947 Gene Symbol: FOLR1 Gene ID (NCBI): 2348 RRID: AB_2879264 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P15328 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.