Iright
BRAND / VENDOR: Proteintech

Proteintech, 23381-1-AP, FBXO33 Polyclonal antibody

CATALOG NUMBER: 23381-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FBXO33 (23381-1-AP) by Proteintech is a Polyclonal antibody targeting FBXO33 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 23381-1-AP targets FBXO33 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, U2OS cells, mouse lung tissue, rat lung tissue Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information F-box Only Protein 33 (FBXO33) is a typical member of the F-box protein family with E3 ligase function. FBXO33 can regulate the ubiquitination and solubility of polyglutamine disease proteins, potentially serving as a target for treating type 3 spinocerebellar ataxia. FBXO33 ligase interferes with YB-1-mediated functions by binding and ubiquitinating the multifunctional regulator Y-box-binding protein 1 (YB-1)/dbpB/p50, leading to proteasomal degradation (PMID: 39206900). The calculated molecular weight of FBXO33 is 63 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20055 Product name: Recombinant human FBXO33 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 210-555 aa of BC068566 Sequence: DISVLQQQGSLSNTYLSKVDPDGKKIKQIQQLFEEILSNSRQLKWLSCGFMLEIVTPTSLSSLSNAVANTMEHLSLLDNNIPGNSTLITAVELERFVNLHSLALDFCDFTAEMARVLTDSNHVPLQRLSLLVHNVSVMHKSLDNMPNDEHWKALSRKSTSFRVYIMAFDIKSEDMLKILKPSIPLERIHFDSYITCVSGAIVDLISRQYDKFLTHFILMNDVIDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARLRGSDLKVLEVTEESIDFDQGELADQDVDPVHNLIEQVSLGLGQPWHAVMDIESLSVFTEPNRHFYREMQSFSEDI Predict reactive species Full Name: F-box protein 33 Calculated Molecular Weight: 555 aa, 63 kDa Observed Molecular Weight: 63 kDa GenBank Accession Number: BC068566 Gene Symbol: FBXO33 Gene ID (NCBI): 254170 RRID: AB_3669413 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z6M2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924