Proteintech, 23415-1-AP, NPFFR1 Polyclonal antibody

Size: 20ul / 150ul The NPFFR1 (23415-1-AP) by Proteintech is a Polyclonal antibody targeting NPFFR1 in WB, ELISA applications with reactivity to human, rat samples 23415-1-AP targets NPFFR1 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: SK-N-SH cells, PC-12 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information NPFFR1 (Neuropeptide FF Receptor 1) is primarily focused on its role in various physiological and pathological processes. NPFFR1 is involved in modulating the effects of opioids, including their analgesic properties and side effects. This interaction has led to research into the potential use of NPFFR1 ligands to enhance opioid efficacy and reduce adverse effects (PMID: 32673481). Research suggests that NPFFR1 may have neuroprotective effects, particularly in the context of stroke recovery. It may promote neuronal survival, axonal growth, and reduce inflammation (PMID: 39519132). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20057 Product name: Recombinant human NPFFR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 339-430 aa of BC131580 Sequence: GFQAAFRARLCPRPSGSHKEAYSERPGGLLHRRVFVVVRPSDSGLPSESGPSSGAPRPGRLPLRNGRVAHHGLPREGPGCSHLPLTIPAWDI Predict reactive species Full Name: neuropeptide FF receptor 1 Calculated Molecular Weight: 430 aa, 48 kDa Observed Molecular Weight: 48-50 kDa GenBank Accession Number: BC131580 Gene Symbol: NPFFR1 Gene ID (NCBI): 64106 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9GZQ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.