Proteintech, 23425-1-AP, ADH7 Polyclonal antibody

Size: 20ul / 150ul The ADH7 (23425-1-AP) by Proteintech is a Polyclonal antibody targeting ADH7 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 23425-1-AP targets ADH7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, HEK-293 cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ADH7(Alcohol dehydrogenase class 4 mu/sigma chain) is also named as gastric alcohol dehydrogenase, retinol dehydrogenase and belongs to the zinc-containing alcohol dehydrogenase family. The ubiquitous expression pattern of ADH7 during embryogenesis has led to the notion that the enzymatic conversion of retinol to retinal occurs more or less uniformly and plays no role in the spatial or temporal regulation of RA synthesis during embryonic development(PMID:17473173). It has 2 isoforms produced by alternative splicing and can exsit as a homodimer(PMID:18479436). Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19340 Product name: Recombinant human ADH7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 253-349 aa of BC131512 Sequence: ISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLA Predict reactive species Full Name: alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide Calculated Molecular Weight: 386 aa, 41 kDa Observed Molecular Weight: 45-47 kDa GenBank Accession Number: BC131512 Gene Symbol: ADH7 Gene ID (NCBI): 131 RRID: AB_2879277 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P40394 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.