Proteintech, 23426-1-AP, CBX6 Polyclonal antibody

Size: 20ul / 150ul The CBX6 (23426-1-AP) by Proteintech is a Polyclonal antibody targeting CBX6 in WB, IHC, ELISA applications with reactivity to human samples 23426-1-AP targets CBX6 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HEK-293 cells, HeLa cells Positive IHC detected in: human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information The Chromobox domain (Cbx) gene family, consisting of Polycomb and Heterochromatin Protein 1 genes, involves in transcriptional repression, cell cycle regulation and chromatin remodeling [PMID: 17486619]. Cbx6, other named neuronal pentraxin receptor (NPR), first described as a putative integral membrane pentraxin that interacts with neuronal pentraxin 1 and 2, has also been classified as a Pc protein [PMID: 14647293]. NPR was determined to be a member of a distinct pentraxin protein subfamily, and found to form heteropentamer swithNP1 andNP2, followed by release from cell membranes [PMID: 10748068]. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20014 Product name: Recombinant human CBX6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 89-336 aa of BC064900 Sequence: ALRISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKVIDKGAGGGGAGQGAGALARPKVPSRNRVIGKSKKFSESVLRTQIRHMKFGAFALYKPPPAPLVAPSPGKAEASAPGPGLLLAAPAAPYDARSSGSSGCPSPTPQSSDPDDTPPKLLPETVSPSAPSWREPEVLDLSLPPESAATSKRAPPEVTAAA Predict reactive species Full Name: chromobox homolog 6 Calculated Molecular Weight: 412 aa, 44 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC064900 Gene Symbol: CBX6 Gene ID (NCBI): 23466 RRID: AB_2737364 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95503 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.