Iright
BRAND / VENDOR: Proteintech

Proteintech, 23501-1-AP, Mammaglobin A Polyclonal antibody

CATALOG NUMBER: 23501-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Mammaglobin A (23501-1-AP) by Proteintech is a Polyclonal antibody targeting Mammaglobin A in WB, IHC, ELISA applications with reactivity to human samples 23501-1-AP targets Mammaglobin A in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information SCGB2A2, also known as mammaglobin A, is a member of the secretoglobin superfamily. It is a breast cancer-associated antigen almost exclusively over-expressed in primary and metastatic human breast cancers, making it a specific molecular marker and a potential therapeutic target for breast cancer. SCGB2A2 is a 93-amino acid protein with a calculated molecular weight of 10.5 kDa. This polyclonal antibody is raised against the C-terminal 71 amino acids of the protein encoded by a cDNA (MGC:71974; BC067220). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20122 Product name: Recombinant human SCGB2A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-120 aa of BC067220 Sequence: IDDNATTNAIDELKECFLNQTDETLSNVEVFMVISFSSYKLFKSPDQGQVGSSFLTDNAKATSEQAFSYIG Predict reactive species Full Name: secretoglobin, family 2A, member 2 Calculated Molecular Weight: 120 aa, 13 kDa Observed Molecular Weight: 6-10 kDa GenBank Accession Number: BC067220 Gene Symbol: Mammaglobin A Gene ID (NCBI): 4250 RRID: AB_2879289 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13296 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924