Proteintech, 23525-1-AP, ESCO2 Polyclonal antibody

Size: 20ul / 150ul The ESCO2 (23525-1-AP) by Proteintech is a Polyclonal antibody targeting ESCO2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 23525-1-AP targets ESCO2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, mouse testis, rat testis Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Background Information ESCO2 is also known as Establishment of Sister Chromatid Cohesion N-Acetyltransferase 2, EFO2. This gene encodes a member of the family of acetyltransferases involved in the establishment of sister chromatid cohesion during S phase and postreplicative sister chromatid cohesion induced by double-strand breaks (PubMed: 15821733). Mutations in the ESCO2 gene are associated with a rare genetic disorder called Roberts syndrome or SC phocomelia syndrome (PubMed: 16380922). The loss of function or impaired activity of the ESCO2 protein due to mutations disrupts the proper cohesion of sister chromatids, leading to chromosomal abnormalities and the characteristic features of Roberts syndrome. ESCO2 can be detected as about 65-70 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18893 Product name: Recombinant human ESCO2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-353 aa of BC146562 Sequence: MAALTPRKRKQDSLKCDSLLHFTENLFPSPNKKHCFYQNSDKNEENLHCSQQEHFVLSALKTTEINRLPSANQGSPFKSALSTVSFYNQNKWYLNPLERKLIKESRSTCLKTNDEDKSFPIVTEKMQGKPVCSKKNNKKPQKSLTAKYQPKYRHIKPVSRNSRNSKQNRVIYKPIVEKENNCHSAENNSNAPRVLSQKIKPQVTLQGGAAFFVRKKSSLRKSSLENEPSLGRTQKSKSEVIEDSDVETVSEKKTFATRQVPKCLVLEEKLKIGLLSASSKNKEKLIKDSSDDRVSSKEHKVDKNEAFSSEDSLGENKTISPKSTVYPIFSASSVNSKRSLGEEQFSVGSVNFM Predict reactive species Full Name: establishment of cohesion 1 homolog 2 (S. cerevisiae) Calculated Molecular Weight: 601 aa, 68 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC146562 Gene Symbol: ESCO2 Gene ID (NCBI): 157570 RRID: AB_2879292 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q56NI9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.