Iright
BRAND / VENDOR: Proteintech

Proteintech, 23622-1-AP, TIMMDC1 Polyclonal antibody

CATALOG NUMBER: 23622-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TIMMDC1 (23622-1-AP) by Proteintech is a Polyclonal antibody targeting TIMMDC1 in WB, ELISA applications with reactivity to human samples 23622-1-AP targets TIMMDC1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20017 Product name: Recombinant human TIMMDC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-285 aa of BC012341 Sequence: MEVPPPAPRSFLCRALCLFPRVFAAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRELFGKDEQQRISKDLANICKTAATAGIIGWVYGGIPAFIHAKQQYIEQSQAEIYHNRFDAVQSAHRAATRGFIRYGWRWGWRTAVFVTIFNTVNTSLNVYRNKDALSHFVIAGAVTGSLFRINVGLRGLVAGGIIGALLGTPVGGLLMAFQKYSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDKD Predict reactive species Full Name: chromosome 3 open reading frame 1 Calculated Molecular Weight: 285 aa, 32 kDa Observed Molecular Weight: 32-35 kDa GenBank Accession Number: BC012341 Gene Symbol: TIMMDC1 Gene ID (NCBI): 51300 RRID: AB_2879305 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9NPL8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924