Proteintech, 23631-1-AP, SFMBT1 Polyclonal antibody

Size: 20ul / 150ul The SFMBT1 (23631-1-AP) by Proteintech is a Polyclonal antibody targeting SFMBT1 in WB, ELISA applications with reactivity to human, mouse, rat samples 23631-1-AP targets SFMBT1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: IMR-32 cells, mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Scm-like with four MBT domains protein 1 (SFMBT1) is also named as Renal ubiquitous protein 1 (RU1). SFMBT1 is a transcriptional repressor that associates with chromatin and interacts with the N-terminal tail of histone H3 (PMID: 17599839). SFMBT1 forms a complex with Lys-specific demethylase 1 (LSD1) and they are believed to act together in combination with RNA polymerase II in the transcriptional regulation of histone genes (PMID: 23592795). SFMBT1 is up-regulated in CRC tumor tissues and cells and may be associated with drug resistance (PMID: 35577773). SFMBT1 regulates the expression and interacts with key genes involved in heart muscle and artery development (PWWP2A, as well as myogenic differentiation (MYOD, SIX2) (PMID: 35483874). Testes, endocrine glands, and blood are tissues that highly express SFMBT1 (PMID: 25613900). SFMBT1 is also highly expressed in skeletal muscles specifically in undifferentiated myoblasts, and this expression starts diminishing during muscle differentiation (PMID: 23349461). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20417 Product name: Recombinant human SFMBT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 99-313 aa of BC014614 Sequence: IRKADLYPIGWCEQNKKTLEAPEGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDSLSTWIVTVVENIGGRLKLRYEGLESSDNYEHWLYYLDPFLHHVGWAAQQGYELQPPSAIRHLKNEAEWQEILAKVKEEEEEPLPSYLFKDKQVIGIHTFSVNMKLEAVDPWSPFGISPATVVKVFDEKYFLVEMDDL Predict reactive species Full Name: Scm-like with four mbt domains 1 Calculated Molecular Weight: 866 aa, 98 kDa Observed Molecular Weight: 93-98 kDa GenBank Accession Number: BC014614 Gene Symbol: SFMBT1 Gene ID (NCBI): 51460 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9UHJ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.