Proteintech, 23640-1-AP, MRGPRD Polyclonal antibody

Size: 20ul / 150ul The MRGPRD (23640-1-AP) by Proteintech is a Polyclonal antibody targeting MRGPRD in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 23640-1-AP targets MRGPRD in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse small intestine tissue, rat dorsal root ganglion tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse small intestine tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information MRGPRD (MAS-related G-protein coupled receptor, D), also referred to as hGPCR45 or TGR7, was identified as a novel GPCR in murine and human genomes. As for MRGD, its expression was found in dorsal root ganglia (DRG) and co-localized with Vanilloid receptor-1 (VR-1), which is an essential receptor for heat and pain sensation (PMID: 22715397). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20316 Product name: Recombinant human MRGPRD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 230-321 aa of BC156660 Sequence: FLICSLPLSIYWFVLYWLSLPPEMQVLCFSLSRLSSSVSSSANPVIYFLVGSRRSHRLPTRSLGTVLQQALREEPELEGGETPTVGTNEMGA Predict reactive species Full Name: MAS-related GPR, member D Calculated Molecular Weight: 321 aa, 36 kDa GenBank Accession Number: BC156660 Gene Symbol: MRGPRD Gene ID (NCBI): 116512 RRID: AB_3669414 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q8TDS7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.