Proteintech, 23673-1-AP, UCP1 Polyclonal antibody

Size: 20ul / 150ul The UCP1 (23673-1-AP) by Proteintech is a Polyclonal antibody targeting UCP1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 23673-1-AP targets UCP1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brown adipose tissue, mouse skeletal muscle tissue Positive IHC detected in: mouse brown adipose tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information UCP-1 (Mitochondrial uncoupling protein 1), is a mitochondrial transporter protein that creates proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. It has been identified a key molecule for metabolic thermogenesis to avoid an excess of fat accumulation. UCP-1 expression is usually restricted to brown adipose when induced by cold exposure and thyroid hormone. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, bovine, hamster, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20388 Product name: Recombinant human UCP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-307 aa of BC098168 Sequence: MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSRQTMDCAT Predict reactive species Full Name: uncoupling protein 1 (mitochondrial, proton carrier) Calculated Molecular Weight: 307 aa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC098168 Gene Symbol: UCP1 Gene ID (NCBI): 7350 RRID: AB_2828003 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P25874 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.