Proteintech, 23716-1-AP, ZNF521 Polyclonal antibody

Size: 20ul / 150ul The ZNF521 (23716-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF521 in WB, IF/ICC, ELISA applications with reactivity to human samples 23716-1-AP targets ZNF521 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HuH-7 cells, L02 cells, T2 cells, THP-1 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Zinc finger protein 521 (EHZF/ZNF521) is a transcription co-factor originally identified for its abundant and selective expression in early progenitors of the human hematopoietic system. In the hematopoietic system ZNF521 is highly expressed in stem and progenitor cells but not in more differentiated precursors or mature leukocytes (PMID: 23907569, 21593590). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20540 Product name: Recombinant human ZNF521 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 195-450 aa of BC113648 Sequence: THTSNKPYKCAICRRGFLSSSSLHGHMQVHERNKDGSQSGSRMEDWKMKDTQKCSQCEEGFDFPEDLQKHIAECHPECSPNEDRAALQCVYCHELFVEETSLMNHMEQVHSGEKKNSCSICSESFHTVEELYSHMDSHQQPESCNHSNSPSLVTVGYTSVSSTTPDSNLSVDSSTMVEAAPPIPKSRGRKRAAQQTPDMTGPSSKQAKVTYSCIYCNKQLFSSLAVLQIHLKTMHLDKPEQAHICQYCLEVLPSLY Predict reactive species Full Name: zinc finger protein 521 Calculated Molecular Weight: 1311 aa, 148 kDa Observed Molecular Weight: 190 kDa GenBank Accession Number: BC113648 Gene Symbol: ZNF521 Gene ID (NCBI): 25925 RRID: AB_3669415 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96K83 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.