Proteintech, 23724-1-AP, AIDA Polyclonal antibody

Size: 20ul / 150ul The AIDA (23724-1-AP) by Proteintech is a Polyclonal antibody targeting AIDA in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 23724-1-AP targets AIDA in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse skeletal muscle tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information AIDA, also named as C1orf80, acts as a ventralizing factor during embryogenesis. It inhibits axin-mediated JNK activation by binding axin and disrupting axin homodimerization. It's highest expression in the heart and skeletal muscle. AIDA has three isoforms with MW 35 kDa, 16 kDa and 26 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20588 Product name: Recombinant human AIDA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-306 aa of BC015535 Sequence: MSEVTRSLLQRWGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPVPLRRILAPGEEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLHQTLHKE Predict reactive species Full Name: axin interactor, dorsalization associated Calculated Molecular Weight: 306 aa, 35 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC015535 Gene Symbol: AIDA Gene ID (NCBI): 64853 RRID: AB_2879311 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96BJ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.