Iright
BRAND / VENDOR: Proteintech

Proteintech, 23758-1-AP, TPC1 Polyclonal antibody

CATALOG NUMBER: 23758-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TPC1 (23758-1-AP) by Proteintech is a Polyclonal antibody targeting TPC1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 23758-1-AP targets TPC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Two-pore channels (TPCs) are ancient members of the voltage-gated ion channel superfamily, are thought to be non-selective cation channels permeable to Ca2+. They mediate their physiological effects through releasing Ca2+ from acidic organelles in response to cues such as the second messenger, NAADP (nicotinic acid adenine dinucleotide phosphate). Genetic knockout and pharmacological inhibition experiments demonstrate that the two-pore channels, TPC1 and TPC2, are required for infection by Filoviruses Ebola and Marburg in mice.(PMID: 29746898; PMID 25722412) Two pore segment channel 1 (TPC1) is a human protein encoded by the TPCN1 gene. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20607 Product name: Recombinant human TPCN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC136795 Sequence: MAVSLDDDVPLILTLDEGGSAPLAPSNGLGQEELPSKNGGSYAIHDSQAPSLSSGGESSPSSPAHNWEMNYQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLME Predict reactive species Full Name: two pore segment channel 1 Calculated Molecular Weight: 816 aa, 94 kDa Observed Molecular Weight: 94 kDa GenBank Accession Number: BC136795 Gene Symbol: TPCN1 Gene ID (NCBI): 53373 RRID: AB_2879317 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9ULQ1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924