Proteintech, 23809-1-AP, FATE1 Polyclonal antibody

Size: 20ul / 150ul The FATE1 (23809-1-AP) by Proteintech is a Polyclonal antibody targeting FATE1 in WB, ELISA applications with reactivity to human, mouse samples 23809-1-AP targets FATE1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human testis tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information FATE1 ,also named as Fetal and adult testis expressed transcript protein, express predominantly in testis, with some expression in lung, heart, kidney, adrenal gland and whole brain. FATE might represent a novel target gene of SF-1 in testicular differentiation and germ cell development. FATE1 also involves in the regulation of a wide variety of cellular processes ,including the cell cycle, immune responses, signaling cascades and developmental events through target proteins, such as cyclins, cyclin-dependent kinase inhibitors. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20757 Product name: Recombinant human FATE1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-163 aa of BC022064 Sequence: MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNMTATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATWRHRET Predict reactive species Full Name: fetal and adult testis expressed 1 Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC022064 Gene Symbol: FATE1 Gene ID (NCBI): 89885 RRID: AB_2879328 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q969F0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.