Product Description
Size: 20ul / 150ul
The NDUFC1 (23842-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFC1 in IHC, ELISA applications with reactivity to human samples
23842-1-AP targets NDUFC1 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive IHC detected in: human heart tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:20-1:200
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag20835 Product name: Recombinant human NDUFC1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-76 aa of BC107682 Sequence: MAPSALLRPLSRLLAPARLPSGPSVRSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGLE Predict reactive species
Full Name: NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 1, 6kDa
Calculated Molecular Weight: 76 aa, 9 kDa
GenBank Accession Number: BC107682
Gene Symbol: NDUFC1
Gene ID (NCBI): 4717
RRID: AB_2879336
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O43677
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924