Iright
BRAND / VENDOR: Proteintech

Proteintech, 23843-1-AP, ARCN1 Polyclonal antibody

CATALOG NUMBER: 23843-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ARCN1 (23843-1-AP) by Proteintech is a Polyclonal antibody targeting ARCN1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 23843-1-AP targets ARCN1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, A549 cells, Jurkat cells, mouse pancreas tissue, rat pancreas tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Archain 1 (ARCN1), also known as delta-COP, is a subunit of the coat protein I (COPI) complex, which comprises one of the protein coats that mediate vesicle budding from the membrane. Protein sequences of ARCN1 are well conserved among eukaryotes and this protein may play a fundamental role in eukaryotic cell biology. It has similarities to heat shock proteins and clathrin-associated proteins, and may be involved in vesicle structure or trafficking. The gene of ARCN1 has been identified in chromosome band 11q23.3, and sequencing of cDNAs suggests that at least two forms of mRNA with alternative 5' ends are present. (PMID: 7782067; 20502676) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20836 Product name: Recombinant human ARCN1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 164-511 aa of BC093636 Sequence: KELQQARRDAERQGKKAPGFGGFGSSAVSGGSTAAMITETIIETDKPKVAPAPARPSGPSKALKLGAKGKEVDNFVDKLKSEGETIMSSSMGKRTSEATKMHAPPINMESVHMKIEEKITLTCGRDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFTAESLIGLKNPEKSFPVNSDVGVLKWRLQTTEESFIPLTINCWPSESGNGCDVNIEYELQEDNLELNDVVITIPLPSGVGAPVIGEIDGEYRHDSRRNTLEWCLPVIDAKNKSGSLEFSIAGQPNDFFPVQVSFVSKKNYCNIQVTKVTQVDGNSPVRFSTETTFLVDKYEIL Predict reactive species Full Name: archain 1 Calculated Molecular Weight: 511 aa, 57 kDa Observed Molecular Weight: 57 kDa, 47 kDa GenBank Accession Number: BC093636 Gene Symbol: ARCN1 Gene ID (NCBI): 372 RRID: AB_2879337 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48444 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924