Iright
BRAND / VENDOR: Proteintech

Proteintech, 23844-1-AP, SCF Polyclonal antibody

CATALOG NUMBER: 23844-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SCF (23844-1-AP) by Proteintech is a Polyclonal antibody targeting SCF in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 23844-1-AP targets SCF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Stem cell factor (SCF) is also named as mast cell growth factor (MGF), Kit ligand (Kitl), c-Kit ligand, steel factor and Kitlg. SCF is a pleiotropic cytokine (also as a dimeric molecule) that mediates regulatory effects on inflammation, tissue remodeling, and fibrosis through binding to and activating its receptor tyrosine kinase c-Kit (PMID: 1698553, PMID: 8630386, PMID: 23073628). SCF is the ligand of c-Kit, a member of the RTKs family. Molecular activity of RTKs is a primary stimulus of cell motility, and expression of the SCF/c-Kit axis is associated with cell migration (PMID: 28629522). SCF is a cytokine that synergizes the effects of Epo during erythropoiesis. Stem cell factor plays a well-described role in regulating the survival, proliferation, migration, and differentiation of hematopoietic progenitors, melanocytes, and germ cells (PMID: 36688460). More recent studies have demonstrated SCF expression in dermal and intestinal epithelial cells, and increased SCF expression has been reported in the inflamed mucosa of individuals with IBD and colonitis (PMID: 18200049, PMID: 30157426). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20837 Product name: Recombinant human SCF protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-273 aa of BC074725 Sequence: MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKEREFQEV Predict reactive species Full Name: KIT ligand Calculated Molecular Weight: 273 aa, 31 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC074725 Gene Symbol: SCF Gene ID (NCBI): 4254 RRID: AB_3669419 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P21583 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924