Iright
BRAND / VENDOR: Proteintech

Proteintech, 23845-1-AP, NARG1 Polyclonal antibody

CATALOG NUMBER: 23845-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NARG1 (23845-1-AP) by Proteintech is a Polyclonal antibody targeting NARG1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 23845-1-AP targets NARG1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells Positive IHC detected in: human stomach cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NAA15 (N-alpha-acetyltransferase 15) is a subunit of both the NatA and NatE complexes, and its role is to position the catalytic subunits in close vicinity to the nascent polypeptides (PMID: 33557580). Human NAA15 encodes an 866 amino acid (~105 kDa) protein, NAA15, containing tetratricopeptide repeat domains and a putative bipartite nuclear localization signal (PMID: 29656860). NAA15 was implicated in human disease and loss-of-function NAA15 variants in large cohorts of patients with autism spectrum disorder and/or ID (PMID: 33103328). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20842 Product name: Recombinant human NARG1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-350 aa of BC093928 Sequence: MPAVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKEEAYELVRRGLRNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLLQIQMRDLEGYRETRYQLLQLRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTSPDKVDYEYSELLLYQNQVLREAGLYREALEHLCTYEKQICDKLAVEETKGELLLQLCRLEDAADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKYPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKGCPPVFNTLRSLYKDKEKVAIIEELVVGYE Predict reactive species Full Name: NMDA receptor regulated 1 Calculated Molecular Weight: 866 aa, 101 kDa Observed Molecular Weight: 95-100 kDa GenBank Accession Number: BC093928 Gene Symbol: NARG1 Gene ID (NCBI): 80155 RRID: AB_2879338 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9BXJ9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924