Proteintech, 23855-1-AP, NDUFB5 Polyclonal antibody

Size: 20ul / 150ul The NDUFB5 (23855-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFB5 in WB, IHC, ELISA applications with reactivity to human, mouse samples 23855-1-AP targets NDUFB5 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse spleen tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Specification Tested Reactivity: human, mouse Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20907 Product name: Recombinant human NDUFB5 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-189 aa of BC005271 Sequence: MAAMSLLRRVSVTAVAALSGRPLGTRLGFGGFLTRGFPKAAAPVRHSGDHGKRLFVIRPSRFYDRRFLKLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa Calculated Molecular Weight: 189 aa, 22 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC005271 Gene Symbol: NDUFB5 Gene ID (NCBI): 4711 RRID: AB_2879342 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: O43674 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.