Iright
BRAND / VENDOR: Proteintech

Proteintech, 23872-1-AP, TRHR Polyclonal antibody

CATALOG NUMBER: 23872-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRHR (23872-1-AP) by Proteintech is a Polyclonal antibody targeting TRHR in WB, ELISA applications with reactivity to human, mouse samples 23872-1-AP targets TRHR in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information TRHR is a Gq-coupled neuroendocrine GPCR that mediates the actions of thyrotropin-releasing hormone in the anterior pituitary and brain. By activating PLC-Ca²⁺ signaling, TRHR controls TSH secretion, regulates thyroid hormone output, and influences metabolic rate and neuroendocrine behavior. Genetic or functional disruption of TRHR leads to central hypothyroidism and broader metabolic and neurological consequences, highlighting its essential role in HPT axis regulation. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20612 Product name: Recombinant human TRHR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 310-398 aa of BC113360 Sequence: YLNSAINPVIYNLMSQKFRAAFRKLCNCKQKPTEKPANYSVALNYSVIKESDHFSTELDDITVTDTYLSATKVSFDDTCLASEVSFSQS Predict reactive species Full Name: thyrotropin-releasing hormone receptor Calculated Molecular Weight: 398 aa, 45 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC113360 Gene Symbol: TRHR Gene ID (NCBI): 7201 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P34981 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924