Product Description
Size: 20ul / 150ul
The ODF2L (23887-1-AP) by Proteintech is a Polyclonal antibody targeting ODF2L in WB, ELISA applications with reactivity to human, mouse, rat samples
23887-1-AP targets ODF2L in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HEK-293 cells, mouse kidney tissue, rat kidney tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Background Information
ODF2L, also named as KIAA1229, has many isoforms with MW 60-80 kDa. The function of ODF2L (Outer dense fiber protein 2-like) remains largely unknown.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag20897 Product name: Recombinant human ODF2L protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-38 aa of BC009779 Sequence: SLETKIAKWNLQSRMNKNEAIVMKEASRQKTVALKKGI Predict reactive species
Full Name: outer dense fiber of sperm tails 2-like
Calculated Molecular Weight: 513 aa, 60 kDa
Observed Molecular Weight: 60-74 kDa
GenBank Accession Number: BC009779
Gene Symbol: ODF2L
Gene ID (NCBI): 57489
RRID: AB_2879351
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen Affinity purified
UNIPROT ID: Q9ULJ1
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924