Iright
BRAND / VENDOR: Proteintech

Proteintech, 23910-1-AP, AKR1D1 Polyclonal antibody

CATALOG NUMBER: 23910-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AKR1D1 (23910-1-AP) by Proteintech is a Polyclonal antibody targeting AKR1D1 in WB, ELISA applications with reactivity to human, mouse, rat samples 23910-1-AP targets AKR1D1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information AKR1D1 (steroid 5β-reductase) reduces all Δ 4-3-ketosteroids to form 5β-dihydrosteroids, a first step in the clearance of steroid hormones and an essential step in the synthesis of all bile acids. It is also named as SRD5B1 and belongs to the aldo/keto reductase family. This protein has 3 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21009 Product name: Recombinant human AKR1D1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 209-326 aa of BC130627 Sequence: CQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY Predict reactive species Full Name: aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) Calculated Molecular Weight: 326 aa, 37 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC130627 Gene Symbol: AKR1D1 Gene ID (NCBI): 6718 RRID: AB_2879359 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P51857 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924